PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy017824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family CAMTA
Protein Properties Length: 194aa    MW: 22218.5 Da    PI: 6.281
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59525229PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1111.26.1e-3516653118
       CG-1  53 DGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                DG++w+kkkdgktvrE+he+LK g+v+vl+cyYah+een++fqrr+yw+L+eel++ivlvhy+evk
  Ahy017824   1 DGHNWRKKKDGKTVREAHERLKAGSVDVLHCYYAHGEENENFQRRTYWMLDEELSHIVLVHYREVK 66 
                9**************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143751.289171IPR005559CG-1 DNA-binding domain
SMARTSM010761.1E-20166IPR005559CG-1 DNA-binding domain
PfamPF038594.7E-29164IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
DGHNWRKKKD GKTVREAHER LKAGSVDVLH CYYAHGEENE NFQRRTYWML DEELSHIVLV  60
HYREVKATKA NFRGAAKENQ ESLPYAQIDK LPGSTEKEIS LSCSLHPHNY QVPSHTIDTT  120
SMKSTQATEY EEAESALNSY ASSEDYSFLE TQHPVVEKIP DPYCLLQFIN EQEKLCGTPG  180
MNHIMLSQAG KIKX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015957607.11e-133PREDICTED: calmodulin-binding transcription activator 3 isoform X2
SwissprotQ8GSA71e-46CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLI1KT101e-82I1KT10_SOYBN; Uncharacterized protein
TrEMBLA0A0B2R5Z42e-82A0A0B2R5Z4_GLYSO; Calmodulin-binding transcription activator 2
STRINGGLYMA08G14370.14e-82(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.28e-48signal responsive 1